PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008235214.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 638aa    MW: 71825.1 Da    PI: 5.5773
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008235214.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS292.61.1e-892736362374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                      + Ll++Ae v  +++e+a++lL r + +as +g+p+qR+++yf+eAL++r+ r++ ++ ++ +  + s +  s++l+ + ++++  P++ + ++
  XP_008235214.1 273 AHILLAAAEKVGYQQFERANRLLLRCEWIASFKGNPIQRVVFYFAEALRERIERETGSIPSKAEEMSISGHGLSTNLT-YLAYYQEVPFHSVMQF 366
                     699***************************************************777777666555555444555544.45588888******** PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     t  qaI e+v+  ++vH iD++i  G+QW  L+++La+R+e p   l iT+vg      k+++eetg+rL+++Ae+l++pf+f++++ +++ed++
  XP_008235214.1 367 TGIQAIIESVALGSKVHLIDLEIRSGVQWTGLMESLAEREECPVeLLTITAVGV---AGKQKIEETGKRLTSVAESLNIPFQFKAVIISAMEDIK 458
                     ****************************************7666489*******...589*********************************** PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikv 285
                      + ++v+ +Ea+aV   l l ++ +++ +le+    +++++++l P ++vv+e ea+hns+sF++rf++al yysa+fd+le+ +  ++ee +++
  XP_008235214.1 459 DQLFDVEDDEAVAVYAPLILRTMISRPSCLEN----LMRVMRNLTPCIMVVIEVEANHNSPSFVNRFIDALFYYSAFFDCLETCM--KQEEYRML 547
                     ************************88888888....***********************************************96..66666777 PP

            GRAS 286 ErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      + ll++ i+n+va+eg+er++r  ++  Wr+ + ++G+ ++++s+    qa+l+ ++++    +++ + ++l+ gWk+ p+ svSaW+
  XP_008235214.1 548 TEDLLREGIRNIVAAEGSERVARSVKMDVWRAFFARFGMVEMNFSNASLYQASLVAKRFGCPSCTLDRNGKCLIVGWKGTPIHSVSAWK 636
                     7777********************************************************999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.101246616IPR005202Transcription factor GRAS
PfamPF035143.7E-87273636IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 638 aa     Download sequence    Send to blast
MANAFFPFTP FDFGVLGGLT PQLEDYEKDQ EVAFKVKPGH LFAIEELGLG EVDSALSSEH  60
GFHQEDSKAK KGGLSSHFSK DPKPTYALSD NFNFDIVSSE HGFHQSNKSE KGLAHLFNDQ  120
DHRHYQQHHH YQQQQPKSNL DNFNFDFAFP PAQPIQDGTH QLTYNQFGGS DIAETNKHLP  180
HQSSLAVLEL LNSYGSAFKK LRGERTSSDT GNEAEASSYV GQQKLSTEEI MRVAGARYVQ  240
FSNQGYGDFY PLHPFGYALT GLSEEETKDA ELAHILLAAA EKVGYQQFER ANRLLLRCEW  300
IASFKGNPIQ RVVFYFAEAL RERIERETGS IPSKAEEMSI SGHGLSTNLT YLAYYQEVPF  360
HSVMQFTGIQ AIIESVALGS KVHLIDLEIR SGVQWTGLME SLAEREECPV ELLTITAVGV  420
AGKQKIEETG KRLTSVAESL NIPFQFKAVI ISAMEDIKDQ LFDVEDDEAV AVYAPLILRT  480
MISRPSCLEN LMRVMRNLTP CIMVVIEVEA NHNSPSFVNR FIDALFYYSA FFDCLETCMK  540
QEEYRMLTED LLREGIRNIV AAEGSERVAR SVKMDVWRAF FARFGMVEMN FSNASLYQAS  600
LVAKRFGCPS CTLDRNGKCL IVGWKGTPIH SVSAWKFR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-3430263633375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008235214.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLM5VUD50.0M5VUD5_PRUPE; Uncharacterized protein
STRINGVIT_07s0005g01500.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.12e-53RGA-like 1